General Information

  • ID:  hor002559
  • Uniprot ID:  A0A7M7GM99
  • Protein name:  Neuropeptide like precursor 1
  • Gene name:  LOC100577694
  • Organism:  Apis mellifera (Honeybee)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  NVGTLARDFALPP
  • Length:  13(243-255)
  • Propeptide:  MVEMAYIRKLTRTLPVLRFGEPHWEDISDLVCEMGLTGNHLVTLLLYVAVVNEIRLPLVTCQDEDSTQCMPKTAFLALLRHPEVSSSLAAYSRAARVTQDTKSRNDMAHLRALTEEGDDTEICVPGRVYLQLLKDPVVRGDLSAILNGRTQKVPDLLGRLIDDTDQMDAREYPFEYQKRSIATLAKNDDLPISLHDRMAENEDDEEKRAVISSSDHSIIRDYLPPNGRSEEQALRDFSMEKRNVGTLARDFALPP
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7GM99-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002559_AF2.pdbhor002559_ESM.pdb

Physical Information

Mass: 158480 Formula: C62H99N17O18
Absent amino acids: CEHIKMQSWY Common amino acids: ALP
pI: 6.34 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 6
Hydrophobicity: 18.46 Boman Index: -1143
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 97.69
Instability Index: 2000 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera